PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10007832m
Common NameEUTSA_v10007832mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family SBP
Protein Properties Length: 396aa    MW: 43810.7 Da    PI: 8.0985
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10007832mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP126.51.1e-39174250177
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                      +Cq++gCe dls+ak+yhr+h+vCe+hsk+p+v+v gle+rfCqqCsr h++sefDe+krsCr+rL++hn+rrrk+q
  Thhalv10007832m 174 RCQIDGCELDLSSAKDYHRKHRVCEKHSKCPKVIVGGLERRFCQQCSRLHAVSEFDEKKRSCRKRLSHHNARRRKPQ 250
                      6**************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.7E-32167236IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.906172249IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.79E-37173252IPR004333Transcription factor, SBP-box
PfamPF031102.8E-30175248IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010358Biological Processleaf shaping
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MDCNMISPMW EWENLIMSNL SKTENDKKPP SIEWETEKGE GIESIFPCFP GLERVSSVSA  60
TSFWQTAVSK SSQSASTNSS SPEVKQTQLA SECSPGDSCS NIDFVQVKAS TATDVYGASA  120
ESDLCLKLGK QTYSEEFWGR NSNDISAVST KLLTPSVVAR KKSKSCGQSV QVPRCQIDGC  180
ELDLSSAKDY HRKHRVCEKH SKCPKVIVGG LERRFCQQCS RLHAVSEFDE KKRSCRKRLS  240
HHNARRRKPQ GGFPMNSERV YDRRQQTNML WNGLSLNTRS EEKYAWSTTC DTNPGQMESG  300
FTLSFQRGHG SEEHLHASNS RSFSAYQTSG GFSAGKSNSQ LPGKGVGEYS GGLHESQEFY  360
SALSLLSTSS DSHGTKHNPM VEPQPIHGTF PTHFI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-251752481184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1230247KKRSCRKRLSHHNARRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006415770.10.0hypothetical protein EUTSA_v10007832mg
RefseqXP_006415771.10.0hypothetical protein EUTSA_v10007832mg
SwissprotQ8S9L00.0SPL10_ARATH; Squamosa promoter-binding-like protein 10
TrEMBLV4L3010.0V4L301_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.1__2893__AT1G27370.20.0(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27370.40.0squamosa promoter binding protein-like 10